PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G13070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GATA
Protein Properties Length: 125aa    MW: 13473.3 Da    PI: 10.2859
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G13070.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.97.7e-202155135
             GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                     C+ C++t+Tp+WR+gp g+++LCnaCG++yrkk++
  LPERR01G13070.1 21 CVECRATTTPMWRSGPTGPRSLCNACGIRYRKKRR 55
                     ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.8481551IPR000679Zinc finger, GATA-type
SMARTSM004012.0E-171573IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.52E-131855No hitNo description
Gene3DG3DSA:3.30.50.103.3E-161956IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.27E-132056No hitNo description
PfamPF003201.4E-172155IPR000679Zinc finger, GATA-type
PROSITE patternPS0034402146IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0048527Biological Processlateral root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MGSTDRKVVG IGVGEEGRRS CVECRATTTP MWRSGPTGPR SLCNACGIRY RKKRRQDLGL  60
DLNQPQKQNG EVIPEVKDSN SNSSSGSSSS NLQVVQKRRL LMGVEEAALL LMTLSSPSAS  120
TLLHG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1324001e-135BT132400.1 Oryza sativa clone RRlibD00393 mRNA sequence.
GenBankCT8296261e-135CT829626.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA214F08, full insert sequence.
GenBankCT8415701e-135CT841570.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C102C07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621366.17e-70PREDICTED: GATA transcription factor 23
TrEMBLA0A0D9V0K91e-86A0A0D9V0K9_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g24070.12e-69(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67212854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.12e-18GATA transcription factor 23